Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse beta-Nerve Growth Factor/ beta-NGF (Met130-Arg239)

Source: E.coli. MW :12.4kD. Recombinant Mouse beta-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Met130-Arg239 is expressed. Mouse beta-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. beta-NGF is a potent neurotrophic factor that signals through its receptor beta-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta-NGF also acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival.

Product Specifications

Gene Name

Ngf

Gene ID

18049

UniProt

P01139

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,200mM NaCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SARAF
575575-01 50 µg

SARAF

Ask
View Details
SARAF
575575-02 100 µg

SARAF

Ask
View Details
Anti-C1R Polyclonal Antibody
PHB87501 100 μg

Anti-C1R Polyclonal Antibody

Ask
View Details
ERGIC2 siRNA (Mouse)
CRM7180-01 15 nmol

ERGIC2 siRNA (Mouse)

Ask
View Details
ERGIC2 siRNA (Mouse)
CRM7180-02 30 nmol

ERGIC2 siRNA (Mouse)

Ask
View Details
Mouse Monoclonal Lipoprotein Lipase/LPL Antibody (OTI3A10) [CoraFluor 1]
NBP2-71178CL1 0.1 mL

Mouse Monoclonal Lipoprotein Lipase/LPL Antibody (OTI3A10) [CoraFluor 1]

Ask
View Details