Recombinant Mouse beta-Nerve Growth Factor/ beta-NGF (Met130-Arg239)
Source: E.coli. MW :12.4kD. Recombinant Mouse beta-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Met130-Arg239 is expressed. Mouse beta-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. beta-NGF is a potent neurotrophic factor that signals through its receptor beta-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta-NGF also acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival.
Product Specifications
Gene Name
Ngf
Gene ID
18049
UniProt
P01139
Components
Lyophilized from a 0.2 μm filtered solution of 20mM Tris,200mM NaCl, pH8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items