Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse SLAM Family Member 9/SLAMF9/CD2F-10 (C-6His)

Source: Human Cells. MW :24.7kD. Recombinant Mouse SLAMF9 is produced by our Mammalian expression system and the target gene encoding Phe18-Leu230 is expressed with a 6His tag at the C-terminus. Mouse SLAM family member 9 (Slamf9) is a single-pass type I membrane protein. The SLAMF9 gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. The slamf9 protein may play a role in the immune response.

Product Specifications

Gene Name

Slamf9

Gene ID

98365

UniProt

Q9D780

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FSGDDEDPEEVIGVLQESINLSLEIPSNEEIKHIDWLFQNNIAIVKPGKKGQPAVITAVDPRYRGRVSISESSYSLHISNLTWEDSGLYNAQVNLKTSESHITKSYHLRVYRRLSKPHITVNSNISEEGVCNISLTCSIERAGMDVTYIWLSSQDSTNTSHEGSVLSTSWRPGDKAPSYTCRVSNPVSNISSRRISVGSFCADPGYPEKPSMLVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tef (BC017689) Mouse Tagged ORF Clone
MG203666 10 µg

Tef (BC017689) Mouse Tagged ORF Clone

Ask
View Details
Dctn5 Mouse shRNA Plasmid (Locus ID 59288)
TR515299 1 Kit

Dctn5 Mouse shRNA Plasmid (Locus ID 59288)

Ask
View Details
Mouse Monoclonal CD8 Antibody (12.C7) [Alexa Fluor 594]
NB100-64021AF594 0.1 mL

Mouse Monoclonal CD8 Antibody (12.C7) [Alexa Fluor 594]

Ask
View Details
Raf-1 (phospho Thr269) Polyclonal Antibody
RA29220-01 50 µL

Raf-1 (phospho Thr269) Polyclonal Antibody

Ask
View Details
Raf-1 (phospho Thr269) Polyclonal Antibody
RA29220-02 100 µL

Raf-1 (phospho Thr269) Polyclonal Antibody

Ask
View Details
Anti-Human GUCY2C Antibody (SAA0124)
FHD65610 100 μg

Anti-Human GUCY2C Antibody (SAA0124)

Ask
View Details