Recombinant Mouse C-X-C Motif Chemokine 1/CXCL1/GRO a (C-6His)
Source: Human Cells. MW :9.4kD. Recombinant Mouse C-X-C motif chemokine 1 is produced by our Mammalian expression system and the target gene encoding Arg20-Lys96 is expressed with a 6His tag at the C-terminus. Cxcl1, also called Gro, Gro1, Mgsa or Scyb1, is short for growth-regulated alpha protein. The protein belongs to the intercrine alpha (chemokine CxC) family. The N-terminal processed form KC (5-72) of the protein is produced by proteolytic cleavage after secretion from bone marrow stromal cells, and shows a highly enhanced hematopoietic activity. Cxcl1 has chemotactic activity for neutrophils, and contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, in vitro, suppresses hematopoietic progenitor cell proliferation.
Product Specifications
Gene Name
Cxcl1
Gene ID
14825
UniProt
P12850
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPKVDHHHHHH
Explore Other Products
Browse additional items from our catalog