Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C Motif Chemokine 1/CXCL1/GRO a (C-6His)

Source: Human Cells. MW :9.4kD. Recombinant Mouse C-X-C motif chemokine 1 is produced by our Mammalian expression system and the target gene encoding Arg20-Lys96 is expressed with a 6His tag at the C-terminus. Cxcl1, also called Gro, Gro1, Mgsa or Scyb1, is short for growth-regulated alpha protein. The protein belongs to the intercrine alpha (chemokine CxC) family. The N-terminal processed form KC (5-72) of the protein is produced by proteolytic cleavage after secretion from bone marrow stromal cells, and shows a highly enhanced hematopoietic activity. Cxcl1 has chemotactic activity for neutrophils, and contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, in vitro, suppresses hematopoietic progenitor cell proliferation.

Product Specifications

Gene Name

Cxcl1

Gene ID

14825

UniProt

P12850

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPKVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

XLF Peptide
DF13366-BP 1 mg

XLF Peptide

Sign In for Pricing
View Details
Goat High Mobility Group Protein 1 (HMG1) ELISA Kit
MBS9356704 Inquire

Goat High Mobility Group Protein 1 (HMG1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human FABP6 shRNA (UAS) - Lentiviral human FABP6 shRNA (UAS) (25)
GTR15139469 1 Vial

Lentiviral human FABP6 shRNA (UAS) - Lentiviral human FABP6 shRNA (UAS) (25)

Sign In for Pricing
View Details
SDF-2L1 (h) -PR
sc-76462-PR 10 µM - 20 µL

SDF-2L1 (h) -PR

Sign In for Pricing
View Details
Sunlong Medical™ Human Galectin-3 ELISA Kit
EL0242Hu-01 48 Tests

Sunlong Medical™ Human Galectin-3 ELISA Kit

Sign In for Pricing
View Details
Sunlong Medical™ Human Galectin-3 ELISA Kit
EL0242Hu-02 96 Tests

Sunlong Medical™ Human Galectin-3 ELISA Kit

Sign In for Pricing
View Details