Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CDK2AP2 (C-6His)

Source: Human Cells. MW :14.1kD. Recombinant Human CDK2AP2 is produced by our Mammalian expression system and the target gene encoding Met1-Thr126 is expressed with a 6His tag at the C-terminus. CDK2AP2, also known as DOC1R, is short for cyclin-dependent kinase 2-associated protein 2. The gene CDK2AP2 encodes this protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. It belongs to the CDK2AP family. CDK2AP1 (cyclin-dependent kinase 2-associated protein 1), corresponding to the gene doc-1 (deleted in oral cancer 1), is a tumor suppressor protein. The doc-1 gene is absent or down-regulated in hamster oral cancer cells and in many other cancer cell types. The ubiquitously expressed CDK2AP1 protein is the only known specific inhibitor of CDK2, making it an important component of cell cycle regulation during G (1) -to-S phase transition.

Product Specifications

Gene Name

CDK2AP2

Gene ID

10263

UniProt

O75956

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNARTVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GSTK1 (Glutathione S-transferase kappa 1, GST 13-13, GST Class-kappa, GSTK1-1, Glutathione S-transferase Subunit 13, HDCMD47P) (MaxLight 650)
127597-ML650 100 µL

GSTK1 (Glutathione S-transferase kappa 1, GST 13-13, GST Class-kappa, GSTK1-1, Glutathione S-transferase Subunit 13, HDCMD47P) (MaxLight 650)

Ask
View Details
CD70 discontinued
387185-01 20 µL

CD70 discontinued

Ask
View Details
CD70 discontinued
387185-02 200 µL

CD70 discontinued

Ask
View Details
VASP Peptide - C-terminal region
MBS3240042-01 0.1 mg

VASP Peptide - C-terminal region

Ask
View Details
VASP Peptide - C-terminal region
MBS3240042-02 5x 0.1 mg

VASP Peptide - C-terminal region

Ask
View Details
GALNT1 Knockout A549 Polyclonal Cells
ARG10501 1 Million

GALNT1 Knockout A549 Polyclonal Cells

Ask
View Details