Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Folate Receptor a/FOLR1 (C-6His)

Source: Human Cells. MW :25.7kD. Recombinant Human Folate Receptor alpha is produced by our Mammalian expression system and the target gene encoding Arg25-Ser234 is expressed with a 6His tag at the C-terminus. Folate receptor alpha (FOLR) belongs to the folate receptor family, and is primarily expressed in tissues of epithelial origin. It is also expressed in kidney, lung and cerebellum. The secreted form is derived from the membrane-bound form either by cleavage of the GPI anchor, or/and by proteolysis catalyzed by a metalloprotease. FOLR1 binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. It has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. It is required for normal embryonic development and normal cell proliferation.

Product Specifications

Gene Name

FOLR1

Gene ID

2348

UniProt

P15328

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HIV (HIV1-HXB2) P24 Protein, His tag
S0A2078-01 10 µg

HIV (HIV1-HXB2) P24 Protein, His tag

Ask
View Details
HIV (HIV1-HXB2) P24 Protein, His tag
S0A2078-02 1 mg

HIV (HIV1-HXB2) P24 Protein, His tag

Ask
View Details
HIV (HIV1-HXB2) P24 Protein, His tag
S0A2078-03 500 µg

HIV (HIV1-HXB2) P24 Protein, His tag

Ask
View Details
HIV (HIV1-HXB2) P24 Protein, His tag
S0A2078-04 25 µg

HIV (HIV1-HXB2) P24 Protein, His tag

Ask
View Details
HIV (HIV1-HXB2) P24 Protein, His tag
S0A2078-05 50 µg

HIV (HIV1-HXB2) P24 Protein, His tag

Ask
View Details
HIV (HIV1-HXB2) P24 Protein, His tag
S0A2078-06 100 µg

HIV (HIV1-HXB2) P24 Protein, His tag

Ask
View Details