Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb (Pro143-Ser288)

Source: E.coli. MW :17.3kD. Recombinant Human Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Pro143-Ser288 is expressed. FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells.

Product Specifications

Gene Name

FGF2

Gene ID

2247

UniProt

P09038

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cy7 Maleimide
CA2070 1 mg

Cy7 Maleimide

Ask
View Details
DIO1 (Type I Iodothyronine Deiodinase, Type-I 5'-deiodinase, Type 1 DI, DIOI, 5DI, TXDI1, ITDI1) (PE)
125850-PE 100 µL

DIO1 (Type I Iodothyronine Deiodinase, Type-I 5'-deiodinase, Type 1 DI, DIOI, 5DI, TXDI1, ITDI1) (PE)

Ask
View Details
3-Phenyl-2-propynenitrile
GW4341-5g 5 g

3-Phenyl-2-propynenitrile

Ask
View Details
ZNF238 Recombinant Protein Antigen
NBP3-21367PEP 100 µL

ZNF238 Recombinant Protein Antigen

Ask
View Details
Patatin-Like Phospholipase Domain-Containing Protein 6 (PNPLA6) Antibody
abx327628-01 50 µg

Patatin-Like Phospholipase Domain-Containing Protein 6 (PNPLA6) Antibody

Ask
View Details
Patatin-Like Phospholipase Domain-Containing Protein 6 (PNPLA6) Antibody
abx327628-02 100 µg

Patatin-Like Phospholipase Domain-Containing Protein 6 (PNPLA6) Antibody

Ask
View Details