Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb (Pro143-Ser288)

Source: E.coli. MW :17.3kD. Recombinant Human Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Pro143-Ser288 is expressed. FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells.

Product Specifications

Gene Name

FGF2

Gene ID

2247

UniProt

P09038

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SMN1 Rabbit Monoclonal Antibody [KD Validation]
E51K2673 40 µL

SMN1 Rabbit Monoclonal Antibody [KD Validation]

Ask
View Details
Lentiviral human CAMTA1 shRNA (UAS) - Lentiviral human CAMTA1 shRNA (UAS, RFP) (25)
GTR15346454 1 Vial

Lentiviral human CAMTA1 shRNA (UAS) - Lentiviral human CAMTA1 shRNA (UAS, RFP) (25)

Ask
View Details
pMC.CMV-rRFP-SV40PolyA (positive control)
MN602A-1 10 µg

pMC.CMV-rRFP-SV40PolyA (positive control)

Ask
View Details
MYH7B Antibody
A29227-50UG 50 µg

MYH7B Antibody

Ask
View Details
ADAPTERS, TUBING STRAIGHT
2068606A/1 1 Each

ADAPTERS, TUBING STRAIGHT

Ask
View Details