Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast Growth Factor 2/FGF-2/FGFb (Pro143-Ser288)

Source: E.coli. MW :17.3kD. Recombinant Human Fibroblast growth factor 2 is produced by our E.coli expression system and the target gene encoding Pro143-Ser288 is expressed. FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family.The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells.

Product Specifications

Gene Name

FGF2

Gene ID

2247

UniProt

P09038

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC7 Antibody
8C10020-AAT 50 µg

CDC7 Antibody

Sign In for Pricing
View Details
Myelin PLP Recombinant Rabbit Monoclonal Antibody [PSH08-21]
HA722964 100 µL

Myelin PLP Recombinant Rabbit Monoclonal Antibody [PSH08-21]

Sign In for Pricing
View Details
FADS1 (NM_013402) Human Over-expression Lysate
LY402257 100 µg

FADS1 (NM_013402) Human Over-expression Lysate

Sign In for Pricing
View Details
IGFBP4 (NM_001552) Human Over-expression Lysate
LC419861 20 µg

IGFBP4 (NM_001552) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Labeled HBsAg Recombinant Protein, 1mL 10nm
GM-601-10 1 mL

Colloidal Gold Labeled HBsAg Recombinant Protein, 1mL 10nm

Sign In for Pricing
View Details
CROCCP3 Antibody
KC-3715-01 50 μL

CROCCP3 Antibody

Sign In for Pricing
View Details