Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human VAMPB/VAPB (C-6His)

Source: E.coli. MW :16kD. Recombinant Human VAMPB is produced by our E.coli expression system and the target gene encoding Ala2-Pro132 is expressed with a 6His tag at the C-terminus. vesicle-associated membrane protein-associated protein B/C (VAPB) is presents in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane. It can form homodimer, and heterodimer with VAPA. It also interacts with VAMP1, VAMP2, HCV NS5A, NS5B, ZFYVE27 and RMDN3. VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in cellular calcium homeostasis regulation.

Product Specifications

Gene Name

VAPB

Gene ID

9217

UniProt

O95292

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPLEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CCKAR siRNA (Mouse)
MBS8207166-01 15 nmol

CCKAR siRNA (Mouse)

Ask
View Details
CCKAR siRNA (Mouse)
MBS8207166-02 30 nmol

CCKAR siRNA (Mouse)

Ask
View Details
CCKAR siRNA (Mouse)
MBS8207166-03 5x 30 nmol

CCKAR siRNA (Mouse)

Ask
View Details
Human Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit
JL16660-01 48 Tests

Human Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit

Ask
View Details
Human Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit
JL16660-02 96 Tests

Human Nitric Oxide Synthase 1, Neuronal (NOS1) ELISA Kit

Ask
View Details
Rabbit 1, 25-dihydroxyvitamin D (3) 24-hydroxylase, mitochondrial, CYP24A1 ELISA Kit
MBS2607332-01 48 Well

Rabbit 1, 25-dihydroxyvitamin D (3) 24-hydroxylase, mitochondrial, CYP24A1 ELISA Kit

Ask
View Details