Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human VAMPB/VAPB (C-6His)

Source: E.coli. MW :16kD. Recombinant Human VAMPB is produced by our E.coli expression system and the target gene encoding Ala2-Pro132 is expressed with a 6His tag at the C-terminus. vesicle-associated membrane protein-associated protein B/C (VAPB) is presents in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane. It can form homodimer, and heterodimer with VAPA. It also interacts with VAMP1, VAMP2, HCV NS5A, NS5B, ZFYVE27 and RMDN3. VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in cellular calcium homeostasis regulation.

Product Specifications

Gene Name

VAPB

Gene ID

9217

UniProt

O95292

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ATG5 Antibody [PE]
NB110-53818PE 0.1 mL

Rabbit Polyclonal ATG5 Antibody [PE]

Sign In for Pricing
View Details
KIF21A 293 Cell Lysate
406577 0.1 mg

KIF21A 293 Cell Lysate

Sign In for Pricing
View Details
Phospho-Tuberin (Thr1462) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1601440 100 µL

Phospho-Tuberin (Thr1462) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
ECM2 Peptide
DF13455-BP 1 mg

ECM2 Peptide

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone:15A10]
E45M15915 100 µg

TTF1 (NKX2-1) Mouse Monoclonal Antibody [Clone:15A10]

Sign In for Pricing
View Details
LGALS3 Antibody (C-term)
AM1951b 400 µL

LGALS3 Antibody (C-term)

Sign In for Pricing
View Details