Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PRL- 2/PTP4A2 (C-6His)

Source: E.coli. MW :20.2kD. Recombinant Human Phosphatase of Regenerating Liver 2 is produced by our E.coli expression system and the target gene encoding Met1-Gln167 is expressed with a 6His tag at the C-terminus. PTP4A2, also known as PRL2 or PTPCAAX2, is short for Protein tyrosine phosphatase type IVA 2. This protein exists in cell membrane, cytoplasm, endosome and membrane. PTP4A2 is often farnesylated during post-translational modification. Farnesylation is required for membrane targeting and for interaction with RABGGTB. The unfarnesylated forms are redirected to the nucleus and cytosol. It can stimulate progression from G1 into S phase during mitosis and promotes tumors. It also inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB.

Product Specifications

Gene Name

PTP4A2

Gene ID

8073

UniProt

Q12974

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQLEHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Androsterone 50mg
A17043-50 50 mg

Androsterone 50mg

Ask
View Details
MAP Kinase Interacting Serine/threonine Kinase 1, Recombinant, Human (MAP Kinase Signal-integrating Kinase 1, MAPK Signal-integrating Kinase 1, MKNK1, MNK1)
MBS637491-01 0.01 mg

MAP Kinase Interacting Serine/threonine Kinase 1, Recombinant, Human (MAP Kinase Signal-integrating Kinase 1, MAPK Signal-integrating Kinase 1, MKNK1, MNK1)

Ask
View Details
MAP Kinase Interacting Serine/threonine Kinase 1, Recombinant, Human (MAP Kinase Signal-integrating Kinase 1, MAPK Signal-integrating Kinase 1, MKNK1, MNK1)
MBS637491-02 5x 0.01 mg

MAP Kinase Interacting Serine/threonine Kinase 1, Recombinant, Human (MAP Kinase Signal-integrating Kinase 1, MAPK Signal-integrating Kinase 1, MKNK1, MNK1)

Ask
View Details
Lentiviral human GRIK3 shRNA (UAS) - Lentiviral human GRIK3 shRNA (UAS) (100)
GTR15341697 1 Vial

Lentiviral human GRIK3 shRNA (UAS) - Lentiviral human GRIK3 shRNA (UAS) (100)

Ask
View Details
AF647 Anti-Mouse CD122 Antibody
JOT20478F 25μg

AF647 Anti-Mouse CD122 Antibody

Ask
View Details
Human FAM83C siRNA
abx916413-01 15 nmol

Human FAM83C siRNA

Ask
View Details