Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PRL- 2/PTP4A2 (C-6His)

Source: E.coli. MW :20.2kD. Recombinant Human Phosphatase of Regenerating Liver 2 is produced by our E.coli expression system and the target gene encoding Met1-Gln167 is expressed with a 6His tag at the C-terminus. PTP4A2, also known as PRL2 or PTPCAAX2, is short for Protein tyrosine phosphatase type IVA 2. This protein exists in cell membrane, cytoplasm, endosome and membrane. PTP4A2 is often farnesylated during post-translational modification. Farnesylation is required for membrane targeting and for interaction with RABGGTB. The unfarnesylated forms are redirected to the nucleus and cytosol. It can stimulate progression from G1 into S phase during mitosis and promotes tumors. It also inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB.

Product Specifications

Gene Name

PTP4A2

Gene ID

8073

UniProt

Q12974

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQLEHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HZ-166
MBS3605302-01 5 mg

HZ-166

Sign In for Pricing
View Details
HZ-166
MBS3605302-02 50 mg

HZ-166

Sign In for Pricing
View Details
HZ-166
MBS3605302-03 100 mg

HZ-166

Sign In for Pricing
View Details
HZ-166
MBS3605302-04 5x 100 mg

HZ-166

Sign In for Pricing
View Details
Anti-Human FOXP1 Polyclonal Antibody
HV703014-01 50 µg

Anti-Human FOXP1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human FOXP1 Polyclonal Antibody
HV703014-02 100 µg

Anti-Human FOXP1 Polyclonal Antibody

Sign In for Pricing
View Details