Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand

Source: E.coli. MW :18.4kD. Recombinant Mouse Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Lys26-Ala189 is expressed. Mouse stem cell factor (SCF), is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. It also promotes phosphorylation of PIK3R1, which is the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5.

Product Specifications

Gene Name

Kitlg

Gene ID

17311

UniProt

P20826

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Human CD21/CR2 Antibody (SAA1459)
FHD36820 100 μg

Anti-Human CD21/CR2 Antibody (SAA1459)

Ask
View Details
ARF1 (NM_001024228) Human Tagged ORF Clone
RC212099 10 µg

ARF1 (NM_001024228) Human Tagged ORF Clone

Ask
View Details
Lentiviral human EPB41L2 sgRNA gene knockout kit - Lentiviral human EPB41L2 sgRNA gene knockout kit (100)
GTR15374509 1 Vial

Lentiviral human EPB41L2 sgRNA gene knockout kit - Lentiviral human EPB41L2 sgRNA gene knockout kit (100)

Ask
View Details
Lentiviral human PLP1 sgRNA gene knockout kit - Lentiviral human PLP1 sgRNA gene knockout kit (25)
GTR15375210 1 Vial

Lentiviral human PLP1 sgRNA gene knockout kit - Lentiviral human PLP1 sgRNA gene knockout kit (25)

Ask
View Details
2-Aminopent-4-enoic acid
MBS3848343-01 250 mg

2-Aminopent-4-enoic acid

Ask
View Details
2-Aminopent-4-enoic acid
MBS3848343-02 500 mg

2-Aminopent-4-enoic acid

Ask
View Details