Recombinant Mouse Fc gamma RII/CD32b/FCGR2 (C-6His)

Source: Human Cells. MW :21.6kD. Recombinant Mouse Fc gamma RII is produced by our Mammalian expression system and the target gene encoding Thr30-Pro210 is expressed with a 6His tag at the C-terminus. Low affinity immunoglobulin gamma Fc region receptor II (CD32B) is a single-pass type I membrane protein and contains 2 Ig-like C2-type (immunoglobulin-like) domains. The inhibitory CD32B is expressed on B cells and myeloid dendritic cells. Ligation of CD32B on B cells downregulates antibody production and may, in some circumstances, promote apoptosis. Co-ligation of CD32B on dendritic cells inhibits maturation and blocks cell activation. CD32B may also be a target formonoclonal antibody therapy for malignancies.

Product Specifications

Gene Name

Fcgr2

Gene ID

14130

UniProt

P08101

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVDHHHHHH