Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BOC Protein/BOC (C-6His)

Source: Human Cells. MW :14.2kD. Recombinant Human BOC is produced by our Mammalian expression system and the target gene encoding Asp31-Ser157 is expressed with a 6His tag at the C-terminus. Brother of CDO is a protein that in humans is encoded by the BOC gene. CDON and BOC are cell surface receptors of the immunoglobulin (Ig) /fibronectin type III repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.

Product Specifications

Gene Name

BOC

Gene ID

91653

UniProt

Q96DN7

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYSVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CTNNAL1 (NM_003798) Human 3' UTR Clone
SC202192 10 µg

CTNNAL1 (NM_003798) Human 3' UTR Clone

Ask
View Details
CPLX1 Recombinant Protein
32-3584-50 50 µg

CPLX1 Recombinant Protein

Ask
View Details
FBXO7 Polyclonal Antibody
bs-8489R 100 µL

FBXO7 Polyclonal Antibody

Ask
View Details
Mouse Monoclonal GLI-2 Antibody [FITC]
NBP2-23602F 0.1 mL

Mouse Monoclonal GLI-2 Antibody [FITC]

Ask
View Details
CASP7 (Caspase 7) BioAssayTM ELISA Kit (Human) discontinued
382197 96 Tests

CASP7 (Caspase 7) BioAssayTM ELISA Kit (Human) discontinued

Ask
View Details