Recombinant Human BOC Protein/BOC (C-6His)
Source: Human Cells. MW :14.2kD. Recombinant Human BOC is produced by our Mammalian expression system and the target gene encoding Asp31-Ser157 is expressed with a 6His tag at the C-terminus. Brother of CDO is a protein that in humans is encoded by the BOC gene. CDON and BOC are cell surface receptors of the immunoglobulin (Ig) /fibronectin type III repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.
Product Specifications
Gene Name
BOC
Gene ID
91653
UniProt
Q96DN7
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
DLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYSVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items