Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse M-CSF/CSF1 (C-6His)

Source: Human Cells. MW :27kD. Recombinant Mouse Macrophage colony-stimulating factor 1 is produced by our Mammalian expression system and the target gene encoding Lys33-Glu262 is expressed with a 6His tag at the C-terminus. Macrophage colony-stimulating factor 1 (M-csf) is a single-pass type I membrane protein . It is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. M-CSF affects macrophages and monocytes in several ways, including stimulating increased phagocytic and chemotactic activity, and increased tumour cell cytotoxicity. The role of M-CSF is not only restricted to the monocyte/macrophage cell lineage. By interacting with its membrane receptor, M-CSF also modulates the proliferation of earlier hematopoietic progenitors and influence numerous physiological processes involved in immunology, metabolism, fertility and pregnancy.

Product Specifications

Gene Name

Csf1

Gene ID

12977

UniProt

P07141

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLEVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD1 Rabbit Polyclonal Antibody
orb626746-01 50 µg

ENTPD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENTPD1 Rabbit Polyclonal Antibody
orb626746-02 100 µg

ENTPD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Amino-1,2,3,4-tetrahydroisoquinolin-1-one hydrochloride
EFA07552-01 50 mg

5-Amino-1,2,3,4-tetrahydroisoquinolin-1-one hydrochloride

Sign In for Pricing
View Details
5-Amino-1,2,3,4-tetrahydroisoquinolin-1-one hydrochloride
EFA07552-02 0.5 g

5-Amino-1,2,3,4-tetrahydroisoquinolin-1-one hydrochloride

Sign In for Pricing
View Details
PDE4C Antibody
OAAL00235-100UG 100 µg

PDE4C Antibody

Sign In for Pricing
View Details
Olfr875 3'UTR Lenti-reporter-Luc Vector
33510084 1.0 µg

Olfr875 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details