Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Betacellulin/BTC (N-6His)

Source: E.coli. MW :12.2kD. Recombinant Mouse Betacellulin is produced by our E.coli expression system and the target gene encoding Asp32-Gln118 is expressed with a 6His tag at the N-terminus. Mouse Betacellulin is a single type I membrane protein which belongs to the EGF family of cytokines. EGF family has many members including EGF, TGF-a, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin and the Neuregulins. Betacellulin is characterised by a six-cysteine consensus motif that forms three intra-molecular disulfide bonds crucial for binding the ErbB receptor family. Betacellulin is expressed in several tissues and tumor cells including kidney, uterus, liver, pancreas and small intestine. Betacellulin binds and activates ErbB-1 and ErbB-4 homodimers. Betacellulin is thought to play a role in the differentiation of pancreatic beta cells.Human and mouse mature BTC protein are 80% identical at the amino acid sequence level. Betacellulin is involved in many biological processes such as stimulating gastrointestinal growth. It is proteolytically processed from a larger membrane-anchored precursor and is a potent mitogen for a wide variety of cell types.

Product Specifications

Gene Name

Btc

Gene ID

12223

UniProt

Q543J8

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMDGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQ

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) RPC82 Polyclonal Antibody
MBS7141279 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) RPC82 Polyclonal Antibody

Ask
View Details
Nori® Sheep VEGF R3/FLT4 ELISA Kit
GR116080 96 Well

Nori® Sheep VEGF R3/FLT4 ELISA Kit

Ask
View Details
Magic™ Membrane Protein Human RNF26 (Ring finger protein 26) Full Length
MPC4710K Each

Magic™ Membrane Protein Human RNF26 (Ring finger protein 26) Full Length

Ask
View Details
DDDDK-Tag (binds to flag sequnence) Monoclonal Antibody (2C5), HRP Conjugated
BT-MCA1359-01 20 µL

DDDDK-Tag (binds to flag sequnence) Monoclonal Antibody (2C5), HRP Conjugated

Ask
View Details
DDDDK-Tag (binds to flag sequnence) Monoclonal Antibody (2C5), HRP Conjugated
BT-MCA1359-02 50 µL

DDDDK-Tag (binds to flag sequnence) Monoclonal Antibody (2C5), HRP Conjugated

Ask
View Details
DDDDK-Tag (binds to flag sequnence) Monoclonal Antibody (2C5), HRP Conjugated
BT-MCA1359-03 100 µL

DDDDK-Tag (binds to flag sequnence) Monoclonal Antibody (2C5), HRP Conjugated

Ask
View Details