Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual Specificity Protein Phosphatase 3/DUSP3 (N-6His)

Source: E.coli. MW :22.6kD. Recombinant Human Vaccinia Virus VH1-related Phosphatase is produced by our E.coli expression system and the target gene encoding Ser2-Pro185 is expressed with a 6His tag at the N-terminus. Human DUSP3 belongs to the dual specificity protein phosphatase subfamily. DUSPs are a heterogeneous group of protein phosphatases that can dephosphorylate both phosphotyrosine and phosphoserine/phosphothreonine residues within the one substrate. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. DUSPs are major modulators of critical signalling pathways that are dysregulated in various diseases. They negatively regulate members of the mitogen-activated protein kinase superfamily, which are associated with cellular proliferation and differentiation. DUSP3 is expressed in human tissues including breast and ovarian.DUSP3 shows activity both for tyrosine-protein phosphate and serine-protein phosphate, but displays a strong preference toward phosphotyrosines. Human DUSP3 specifically dephosphorylates and inactivates ERK1 and ERK2.

Product Specifications

Gene Name

DUSP3

Gene ID

1845

UniProt

P51452

Components

Supplied as a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Biospin PCR Purification Kit
TRI-C03S1 50T

Biospin PCR Purification Kit

Ask
View Details
BLZF1 (JEM1, Golgin-45, Basic Leucine Zipper Nuclear Factor 1, JEM-1, p45 Basic Leucine-zipper Nuclear Factor, MGC22497) (MaxLight 550)
123953-ML550 100 µL

BLZF1 (JEM1, Golgin-45, Basic Leucine Zipper Nuclear Factor 1, JEM-1, p45 Basic Leucine-zipper Nuclear Factor, MGC22497) (MaxLight 550)

Ask
View Details
Bromo-PEG6-alcohol
MF-0032496-01 100 mg

Bromo-PEG6-alcohol

Ask
View Details
Bromo-PEG6-alcohol
MF-0032496-02 500 mg

Bromo-PEG6-alcohol

Ask
View Details
Integrin Beta1 Polyclonal Antibody
BT-AP04584-01 20 µL

Integrin Beta1 Polyclonal Antibody

Ask
View Details
Integrin Beta1 Polyclonal Antibody
BT-AP04584-02 50 µL

Integrin Beta1 Polyclonal Antibody

Ask
View Details