Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human VEGF-A/VEGF121

Source: E.coli. MW :14.2kD. Recombinant Human Vascular Endothelial Growth Factor A is produced by our E.coli expression system and the target gene encoding Ala27-Arg147 is expressed. Human VEGF121, also known as Vascular endothelial growth factor A, VEGFA, Vascular permeability factor, VPF and VEGF, is a homodimeric, heparin-binding glycoprotein which belongs to the platelet-derived growth factor (PDGF) /vascular endothelial growth factor (VEGF) family. VEGF-A is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis, permeabilization of blood vessels and endothelial cell growth, increasing microvascular permeability, promoting cell migration and inhibiting apoptosis. Alternatively spliced transcript variants of VEGF-A encod either secreted or cell-associated isoforms. The lymphangiogenesis may be promoted by upregulation of VEGF121, which may in turn act in part via induction of VEGF-C. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.

Product Specifications

Gene Name

VEGFA

Gene ID

7422

UniProt

P15692

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Integrin beta 3/CD61 Antibody (909114) [Janelia Fluor 549]
FAB41182I 0.1 mL

Rat Monoclonal Integrin beta 3/CD61 Antibody (909114) [Janelia Fluor 549]

Sign In for Pricing
View Details
GRPEL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
22706066 1.0 µg DNA

GRPEL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant human Cystatin SA/CST2 Protein, His Tag
E40KMP1313 20 µg

Recombinant human Cystatin SA/CST2 Protein, His Tag

Sign In for Pricing
View Details
TEX264 (Testis-expressed Sequence 264 Protein, Putative Secreted Protein Zsig11, ZSIG11, UNQ337/PRO536) (MaxLight 490)
134344-ML490 100 µL

TEX264 (Testis-expressed Sequence 264 Protein, Putative Secreted Protein Zsig11, ZSIG11, UNQ337/PRO536) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral human CD46 shRNA (UAS) - Lentiviral human CD46 shRNA (UAS, iRFP) plasmid
GTR15326671 1 Vial

Lentiviral human CD46 shRNA (UAS) - Lentiviral human CD46 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PROTECTIVE COVER FOR PUSH BUTTONS17X70 Sign & Label Carriers & Holders
PTKIT4 1 Kit (1 Kit x 1 Kit)

PROTECTIVE COVER FOR PUSH BUTTONS17X70 Sign & Label Carriers & Holders

Sign In for Pricing
View Details