Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human FAD-linked Sulfhydryl Oxidase ALR/GFER (N-6His)

Source: E.coli. MW :17.3kD. Recombinant Human GFER is produced by our E.coli expression system and the target gene encoding Met1-Asp125 is expressed with a 6His tag at the N-terminus. GFER is a hepatotrophic growth factor and flavin-linked sulfhydryl oxidase which belongs to the Erv1/ALR family of proteins. GFER is widely expressed in various human tissues. They are two isoforms of this protein. Isoform 1 could regenerate the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen. Isoform 2 may act as an autocrine hepatotrophic growth factor promoting liver regeneration. GFER could also induce the expression of S-adenosylmethionine decarboxyl-ase and ornithine decarboxylases (ODC) . S-adenosylmethionine decarboxyl-ase and ornithine decarboxylases play an important role in the synthesis of polyamines.

Product Specifications

Gene Name

GFER

Gene ID

2671

UniProt

P55789

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain UTI89/UPEC) YHBQ Polyclonal Antibody
MBS7192172 Inquire

Rabbit anti-Escherichia coli (strain UTI89/UPEC) YHBQ Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)
MBS7017694-01 0.02 mg

Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)
MBS7017694-02 0.1 mg

Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)

Sign In for Pricing
View Details
Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)
MBS7017694-03 5x 0.1 mg

Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)

Sign In for Pricing
View Details
RPUSD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
42725111 3x 1.0 µg

RPUSD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae rplF Protein (aa 1-177) (strain ATCC 39541 / Ogawa 395 / O395)
VAng-Cr3040-1mgEcoli 1 mg (E. coli)

Recombinant Vibrio Cholerae rplF Protein (aa 1-177) (strain ATCC 39541 / Ogawa 395 / O395)

Sign In for Pricing
View Details