Recombinant Human FAD-linked Sulfhydryl Oxidase ALR/GFER (N-6His)
Source: E.coli. MW :17.3kD. Recombinant Human GFER is produced by our E.coli expression system and the target gene encoding Met1-Asp125 is expressed with a 6His tag at the N-terminus. GFER is a hepatotrophic growth factor and flavin-linked sulfhydryl oxidase which belongs to the Erv1/ALR family of proteins. GFER is widely expressed in various human tissues. They are two isoforms of this protein. Isoform 1 could regenerate the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen. Isoform 2 may act as an autocrine hepatotrophic growth factor promoting liver regeneration. GFER could also induce the expression of S-adenosylmethionine decarboxyl-ase and ornithine decarboxylases (ODC) . S-adenosylmethionine decarboxyl-ase and ornithine decarboxylases play an important role in the synthesis of polyamines.
Product Specifications
Gene Name
GFER
Gene ID
2671
UniProt
P55789
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MGSSHHHHHHSSGLVPRGSHMMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Explore Other Products
Browse additional items from our catalog