Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C Motif Chemokine 24/CCL24/Eotaxin-2

Source: E.coli. MW :10.3kD. Recombinant Mouse C-C Motif Chemokine 24 is produced by our E.coli expression system and the target gene encoding Val27-Val119 is expressed. Mouse CCL24 is a secreted protein, which is a member of the CC chemokine subfamily. Mouse Ccl24 cDNA encodes a 119 amino acid residue precursor protein, shares approximately 58% amino acid sequence identity with human Ccl24. It is predominantly expressed in the jejunum and spleen and also be induced in the lung by allergen challengeand IL4. Mouse ccl24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Ccl24 is chemotactic for resting T-lymphocytes, eosinophils and can bind to CCR3. LPS and IL4 also differentially regulate the expression of Ccl24 in monocytes and macrophages.

Product Specifications

Gene Name

Ccl24

Gene ID

56221

UniProt

Q9JKC0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Fatty Acid Binding Protein (FABP) ELISA Kit
OM622334 96 Strip Well

Bovine Fatty Acid Binding Protein (FABP) ELISA Kit

Ask
View Details
EUK-134
558418 10.0mg

EUK-134

Ask
View Details
MAPK3
568155-01 50 µg

MAPK3

Ask
View Details
MAPK3
568155-02 100 µg

MAPK3

Ask
View Details
WDR5, NT (WDR5, BIG3, WD repeat-containing protein 5, BMP2-induced 3-kb gene protein) (APC) discontinued
043840-APC 200 µL

WDR5, NT (WDR5, BIG3, WD repeat-containing protein 5, BMP2-induced 3-kb gene protein) (APC) discontinued

Ask
View Details
MMRN1 (NM_007351) Human Over-expression Lysate
LH08628V 100 µg

MMRN1 (NM_007351) Human Over-expression Lysate

Ask
View Details