Recombinant Mouse Tumor Necrosis Factor Receptor II/TNFRSF1B/CD120b (C-6His)

Source: Human Cells. MW :26.4kD. Recombinant Mouse Tumor Necrosis Factor Receptor II is produced by our Mammalian expression system and the target gene encoding Val23-Gly258 is expressed with a 6His tag at the C-terminus. Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) is a member of the Tumor Necrosis Factor Receptor Superfamily. TNFRSF1B contains four TNFR-Cys repeats. TNFRSF1B can be cleaved into the following 2 chains: Tumor necrosis factor receptor superfamily member 1b and membrane form and Tumor necrosis factor-binding protein 2. TNFRSF1B is a receptor with high affinity for TNFSF2/TNF-a and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-a. TNFRSF1B mediates most of the metabolic effects of TNF-a. TNF-a-induced apoptosis suggests that it regulates TNF-a function by antagonizing its biological activity.

Product Specifications

Gene Name

Tnfrsf1b

Gene ID

21938

UniProt

Q545P4

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGGVDHHHHHH