Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage Metalloelastase/MMP12 (C-6His)

Source: Human Cells. MW :53kD. Recombinant Mouse Matrix Metalloproteinase 12 is produced by our Mammalian expression system and the target gene encoding Ala29-Cys473 is expressed with a 6His tag at the C-terminus. Matrix metalloproteinase-12 (MMP12) is a secreted protein.It contains 4 hemopexin repeats and belongs to the peptidase M10A family. MMP12 may be involved in tissue injury and remodeling and have significant elastolytic activity. It can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3.

Product Specifications

Gene Name

Mmp12

Gene ID

17381

UniProt

P34960

Components

Supplied as a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGCVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) CRS1 Polyclonal Antibody
MBS7183506 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) CRS1 Polyclonal Antibody

Ask
View Details
USP3 Polyclonal Antibody, APC-Cy7 Conjugated
bs-4806R-APC-Cy7 100 µL

USP3 Polyclonal Antibody, APC-Cy7 Conjugated

Ask
View Details
PCDHGA5 (Protocadherin gamma-A5, PCDH-gamma-A5, ME3, PCDH-GAMMA-A5, MGC142020) (AP)
MBS6388602-01 0.1 mL

PCDHGA5 (Protocadherin gamma-A5, PCDH-gamma-A5, ME3, PCDH-GAMMA-A5, MGC142020) (AP)

Ask
View Details
PCDHGA5 (Protocadherin gamma-A5, PCDH-gamma-A5, ME3, PCDH-GAMMA-A5, MGC142020) (AP)
MBS6388602-02 5x 0.1 mL

PCDHGA5 (Protocadherin gamma-A5, PCDH-gamma-A5, ME3, PCDH-GAMMA-A5, MGC142020) (AP)

Ask
View Details
Anti-ALDH3B2 antibody
PAab00295 100 µg

Anti-ALDH3B2 antibody

Ask
View Details
Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) CITD Polyclonal Antibody
MBS7177360 Inquire

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) CITD Polyclonal Antibody

Ask
View Details