Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage Metalloelastase/MMP12 (C-6His)

Source: Human Cells. MW :53kD. Recombinant Mouse Matrix Metalloproteinase 12 is produced by our Mammalian expression system and the target gene encoding Ala29-Cys473 is expressed with a 6His tag at the C-terminus. Matrix metalloproteinase-12 (MMP12) is a secreted protein.It contains 4 hemopexin repeats and belongs to the peptidase M10A family. MMP12 may be involved in tissue injury and remodeling and have significant elastolytic activity. It can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3.

Product Specifications

Gene Name

Mmp12

Gene ID

17381

UniProt

P34960

Components

Supplied as a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGCVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Stx8 (BC048479) AAV Particle
MR202878A1V 250 µL

Mouse Stx8 (BC048479) AAV Particle

Ask
View Details
PIN1 inhibitor 6
MF-0112946-01 10 mg

PIN1 inhibitor 6

Ask
View Details
PIN1 inhibitor 6
MF-0112946-02 50 mg

PIN1 inhibitor 6

Ask
View Details
Profenofos [BSA]
DAG-WT1886B 1 mg

Profenofos [BSA]

Ask
View Details
YIPF3 Protein Vector (Rat) (pPM-C-HA)
50613026 500 ng

YIPF3 Protein Vector (Rat) (pPM-C-HA)

Ask
View Details
CYP4A12A siRNA (Mouse)
MBS8239324-01 15 nmol

CYP4A12A siRNA (Mouse)

Ask
View Details