Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukemia Inhibitory Factor/lIF

Source: E.coli. MW :19.9kD. Recombinant Mouse Leukemia Inhibitory Factor is produced by our E.coli expression system and the target gene encoding Ser24-Phe203 is expressed. Mouse Leukemia inhibitory factor (lif) is a secreted protein which belongs to the LIF/OSM family.LIF has been implicated in a many physiological processes including development, hematopoiesis, bone metabolism, and inflammation. it has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.

Product Specifications

Gene Name

Lif

Gene ID

16878

UniProt

P09056

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)
MBS1486304-01 0.02 mg (E-Coli)

Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)
MBS1486304-02 0.02 mg (Yeast)

Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)
MBS1486304-03 0.1 mg (E-Coli)

Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)
MBS1486304-04 0.1 mg (Yeast)

Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)
MBS1486304-05 0.02 mg (Baculovirus)

Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)

Ask
View Details
Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)
MBS1486304-06 0.02 mg (Mammalian-Cell)

Recombinant Sphingopyxis alaskensis Gamma-glutamyl phosphate reductase (proA)

Ask
View Details