Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SOD2/Mn-SOD (N-6His)

Source: E.coli. MW :23.7kD. Recombinant Human Superoxide Dismutase [Mn] Mitochondrial is produced by our E.coli expression system and the target gene encoding Lys25-Lys222 is expressed with a 6His tag at the N-terminus. Superoxide Dismutase (SOD2) is a number of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. The SOD2 protein transforms toxic superoxide and a byproduct of the mitochondrial electron transport chain into hydrogen peroxide and diatomic oxygen. Genetic variation in SOD2 is associated with microvascular complications of diabetes type 6 (MVCD6), idiopathic cardiomyopathy (IDC), sporadic motor neuron disease, and cancer. SOD2 destroys superoxide anion radicals which are usually produced within the cells and which are toxic to biological systems.

Product Specifications

Gene Name

SOD2

Gene ID

6648

UniProt

P04179

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,100mM NaCl,50% glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHHHHHHDDDDKKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C2orf76 Antibody, Biotin conjugated
A56334-50UG 50 µg

C2orf76 Antibody, Biotin conjugated

Ask
View Details
Mouse Delta Sleep-Inducing Peptide (dSIP) Protein
abx167255-01 10 µg

Mouse Delta Sleep-Inducing Peptide (dSIP) Protein

Ask
View Details
Mouse Delta Sleep-Inducing Peptide (dSIP) Protein
abx167255-02 50 µg

Mouse Delta Sleep-Inducing Peptide (dSIP) Protein

Ask
View Details
Mouse Delta Sleep-Inducing Peptide (dSIP) Protein
abx167255-03 100 µg

Mouse Delta Sleep-Inducing Peptide (dSIP) Protein

Ask
View Details
Mouse Delta Sleep-Inducing Peptide (dSIP) Protein
abx167255-04 200 µg

Mouse Delta Sleep-Inducing Peptide (dSIP) Protein

Ask
View Details
Mouse Delta Sleep-Inducing Peptide (dSIP) Protein
abx167255-05 500 µg

Mouse Delta Sleep-Inducing Peptide (dSIP) Protein

Ask
View Details