Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thioredoxin Domain-Containing Protein 12/TXNDC12/ERp18 (C-6His)

Source: Human Cells. MW :16.98kD. Recombinant Human TXNDC12 is produced by our Mammalian expression system and the target gene encoding His27-Leu168 is expressed with a 6His tag at the C-terminus. Thioredoxin Domain-Containing Protein 12 belongs to the thioredoxin superfamily. In this family, proteins possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors. TXNDC12 is widely expressed in many tissues and contains one thioredoxin domain.

Product Specifications

Gene Name

TXNDC12

Gene ID

51060

UniProt

O95881

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APOER2, CT (Low Density Lipoprotein Receptor-related Protein 8, LRP-8, Apolipoprotein E Receptor 2, LRP8) (Biotin) discontinued
A2299-75V-Biotin 200 µL

APOER2, CT (Low Density Lipoprotein Receptor-related Protein 8, LRP-8, Apolipoprotein E Receptor 2, LRP8) (Biotin) discontinued

Ask
View Details
Recombinant Anti-E2F6 Rabbit mAb
CMA5955-01 30 µL

Recombinant Anti-E2F6 Rabbit mAb

Ask
View Details
Recombinant Anti-E2F6 Rabbit mAb
CMA5955-02 50 μL

Recombinant Anti-E2F6 Rabbit mAb

Ask
View Details
Recombinant Anti-E2F6 Rabbit mAb
CMA5955-03 100 µL

Recombinant Anti-E2F6 Rabbit mAb

Ask
View Details
Recombinant Anti-E2F6 Rabbit mAb
CMA5955-04 200 µL

Recombinant Anti-E2F6 Rabbit mAb

Ask
View Details
BSPRY Human shRNA Plasmid Kit (Locus ID 54836)
TR306358 1 Kit

BSPRY Human shRNA Plasmid Kit (Locus ID 54836)

Ask
View Details