Recombinant Human Thioredoxin Domain-Containing Protein 12/TXNDC12/ERp18 (C-6His)
Source: Human Cells. MW :16.98kD. Recombinant Human TXNDC12 is produced by our Mammalian expression system and the target gene encoding His27-Leu168 is expressed with a 6His tag at the C-terminus. Thioredoxin Domain-Containing Protein 12 belongs to the thioredoxin superfamily. In this family, proteins possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors. TXNDC12 is widely expressed in many tissues and contains one thioredoxin domain.
Product Specifications
Gene Name
TXNDC12
Gene ID
51060
UniProt
O95881
Components
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items