Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon Lambda-1/IL-29/IFN-Lambda1 (C-10His)

Source: Human Cells. MW :21.4kD. Recombinant Human Interferon Lambda-1 is produced by our Mammalian expression system and the target gene encoding Gly20-Thr200 is expressed with a 6His at the C-terminus. Interleukin-29 (IL-29) is a secreted protein which belongs to the IL-28/IL-29 family. IL-29 is a cytokine with immunomodulatory activity. IL-29 is highly similar in amino acid sequence to the IL-28. IL-28 and IL-29 are induced by viral infection and showed antiviral activity. IL-28 and IL-29 interacted with a heterodimeric class II cytokine receptor that consisted of IL-10 receptor beta (IL-10R beta) and an orphan class II receptor chain, designated IL-28R alpha. IL-29 plays an important role in host defenses against microbes and its gene is highly upregulated in cells infected with viruses. IL-29 may play a role in antiviral immunity. IL-29 up-regulates MHC class I antigen expression. It is a Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.

Product Specifications

Gene Name

IFNL1

Gene ID

282618

UniProt

Q8IU54

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR62 Knockout HAP1 Polyclonal Cells
ARG34570 1 Million

GPR62 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Rat Hyaluronan synthase 2, HAS2 ELISA Kit
YLA1004RA-01 48 Tests

Rat Hyaluronan synthase 2, HAS2 ELISA Kit

Sign In for Pricing
View Details
Rat Hyaluronan synthase 2, HAS2 ELISA Kit
YLA1004RA-02 96 Tests

Rat Hyaluronan synthase 2, HAS2 ELISA Kit

Sign In for Pricing
View Details
POLB
CSB-CL018302HU 10 μg Plasmid + 200 μL Glycerol

POLB

Sign In for Pricing
View Details
TRIP13 Rabbit Polyclonal Antibody (FITC)
orb2129052 100 µL

TRIP13 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Slc25a21 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3608603 1.0 µg DNA

Slc25a21 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details