Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon Lambda-1/IL-29/IFN-Lambda1 (C-10His)

Source: Human Cells. MW :21.4kD. Recombinant Human Interferon Lambda-1 is produced by our Mammalian expression system and the target gene encoding Gly20-Thr200 is expressed with a 6His at the C-terminus. Interleukin-29 (IL-29) is a secreted protein which belongs to the IL-28/IL-29 family. IL-29 is a cytokine with immunomodulatory activity. IL-29 is highly similar in amino acid sequence to the IL-28. IL-28 and IL-29 are induced by viral infection and showed antiviral activity. IL-28 and IL-29 interacted with a heterodimeric class II cytokine receptor that consisted of IL-10 receptor beta (IL-10R beta) and an orphan class II receptor chain, designated IL-28R alpha. IL-29 plays an important role in host defenses against microbes and its gene is highly upregulated in cells infected with viruses. IL-29 may play a role in antiviral immunity. IL-29 up-regulates MHC class I antigen expression. It is a Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.

Product Specifications

Gene Name

IFNL1

Gene ID

282618

UniProt

Q8IU54

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase
MBS1027365-01 0.02 mg (E-Coli)

Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase

Ask
View Details
Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase
MBS1027365-02 0.1 mg (E-Coli)

Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase

Ask
View Details
Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase
MBS1027365-03 0.02 mg (Yeast)

Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase

Ask
View Details
Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase
MBS1027365-04 0.1 mg (Yeast)

Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase

Ask
View Details
Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase
MBS1027365-05 0.02 mg (Baculovirus)

Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase

Ask
View Details
Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase
MBS1027365-06 0.02 mg (Mammalian-Cell)

Recombinant Salmonella arizonae D-tyrosyl-tRNA (Tyr) deacylase

Ask
View Details