Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ST6 Sialyltransferase 2/ST6GalNAc2 (C-6His)

Source: Human Cells. MW :38.84kD. Recombinant Human ST6GalNAc2 is produced by our Mammalian expression system and the target gene encoding Ser29-Arg374 is expressed with a 6His tag at the C-terminus. Alpha-N-Acetylgalactosaminide a-2,6-Sialyltransferase 2 (ST6GALNAC2) belongs to the glycosyltransferase 29 family that adds sialic acids to the non-reducing ends of glycoconjugates. At the cell surface, these modifications play roles in cell-cell and cell-substrate interactions, bacterial adhesion and protein targeting. ST6GALNAC2 is localized to the Golgi apparatus membrane. ST6GALNAC2 is highly expressed in lactating mammary glands and the adult testis; it is expressed at lower levels in the kidney. ST6GALNAC2 can catalyze 2,6-sialylation of the Tn antigen.

Product Specifications

Gene Name

ST6GALNAC2

Gene ID

10610

UniProt

Q9UJ37

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-100 1x 100 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF405S conjugate, 0.1mg/mL
BNC040416-500 1x 500 µL

Fascin-1 (FSCN1/416), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details