Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ST6 Sialyltransferase 2/ST6GalNAc2 (C-6His)

Source: Human Cells. MW :38.84kD. Recombinant Human ST6GalNAc2 is produced by our Mammalian expression system and the target gene encoding Ser29-Arg374 is expressed with a 6His tag at the C-terminus. Alpha-N-Acetylgalactosaminide a-2,6-Sialyltransferase 2 (ST6GALNAC2) belongs to the glycosyltransferase 29 family that adds sialic acids to the non-reducing ends of glycoconjugates. At the cell surface, these modifications play roles in cell-cell and cell-substrate interactions, bacterial adhesion and protein targeting. ST6GALNAC2 is localized to the Golgi apparatus membrane. ST6GALNAC2 is highly expressed in lactating mammary glands and the adult testis; it is expressed at lower levels in the kidney. ST6GALNAC2 can catalyze 2,6-sialylation of the Tn antigen.

Product Specifications

Gene Name

ST6GALNAC2

Gene ID

10610

UniProt

Q9UJ37

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CXCL9 antibody
FNab05188 100 µg

CXCL9 antibody

Ask
View Details
Human GLDN qPCR Primer Pair
QH73337S 200 Tests

Human GLDN qPCR Primer Pair

Ask
View Details
Interleukin-1 receptor antagonist, active (Il1rn), Recombinant, Mouse
348098 100 µg

Interleukin-1 receptor antagonist, active (Il1rn), Recombinant, Mouse

Ask
View Details
FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (MaxLight 550)
MBS6211555-01 0.1 mL

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (MaxLight 550)

Ask
View Details
FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (MaxLight 550)
MBS6211555-02 5x 0.1 mL

FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (MaxLight 550)

Ask
View Details
FGF4 CRISPRa sgRNA lentivector (set of three targets)(Rat)
20505126 3x 1.0µg DNA

FGF4 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details