Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine Protease Inhibitor A3N/Serpin A3N (C-6His)

Source: Human Cells. MW :45.6kD. Recombinant Mouse Serine Protease Inhibitor A3N is produced by our Mammalian expression system and the target gene encoding Phe21-Lys418 is expressed with a 6His at the C-terminus. Serine protease inhibitor A3N (Serpin A3N) is a serine protease inhibitor that is structurally related to a1 antichymotrypsin encoded by the SERPINA3 gene. Serpin A3N is highly expressed in brain, testis, lung, thymus, and spleen. It is expressed with low levels in bone marrow, kidney and skeletal muscle. Serpin A3N secreted by Sertoli cells may regulate the activity of locally produced Granzyme B. Granzyme B inhibition by Serpin A3N may therefore regulate Granzyme Bmediated killing by cytotoxic lymphocytes, providing a means to disable cellmediated immune responses.

Product Specifications

Gene Name

Serpina3n

UniProt

Q91WP6

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPKHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Leukotriene A4 (LTA4) BioAssayTM ELISA Kit (General)
366268 96 Tests

Leukotriene A4 (LTA4) BioAssayTM ELISA Kit (General)

Ask
View Details
MARCKS (JK-8) : m-IgG1 BP-HRP Bundle
sc-541665 1 Kit

MARCKS (JK-8) : m-IgG1 BP-HRP Bundle

Ask
View Details
CSF2 Monoclonal Antibody
TA399568 100 µg

CSF2 Monoclonal Antibody

Ask
View Details
Bovine Histone H2B Type 1-K (HIST1H2BK) ELISA Kit
MBS9356622-01 48 Well

Bovine Histone H2B Type 1-K (HIST1H2BK) ELISA Kit

Ask
View Details
Bovine Histone H2B Type 1-K (HIST1H2BK) ELISA Kit
MBS9356622-02 96 Well

Bovine Histone H2B Type 1-K (HIST1H2BK) ELISA Kit

Ask
View Details
Bovine Histone H2B Type 1-K (HIST1H2BK) ELISA Kit
MBS9356622-03 5x 96 Well

Bovine Histone H2B Type 1-K (HIST1H2BK) ELISA Kit

Ask
View Details