Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucagon/GCG (C-6His)

Source: Human Cells. MW :18.6kD. Recombinant Human Glucagon is produced by our Mammalian expression system and the target gene encoding Arg21-Lys180 is expressed with a 6His tag at the C-terminus. Glucagon is a secreted protein and belongs to the glucagon family. Glucagon can be cleved into 8 chains, playing an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon can regulates blood glucose by decreasing glycolysis and increasing gluconeogenesis. In addition, Glucagon is involved in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. In the glucagon antagonist, His-53 and Phe-58 are missing. This antagonist has been successfully utilized to reduce glucose concentration in vivo.

Product Specifications

Gene Name

GCG

Gene ID

2641

UniProt

P01275

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,200mM NaCl,1mM DTT,50% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nup210l (NM_001191900) Rat Tagged ORF Clone
RR217705 10 µg

Nup210l (NM_001191900) Rat Tagged ORF Clone

Ask
View Details
FNTA, Human
HY-P701885 1 Each

FNTA, Human

Ask
View Details
Recombinant Cytosolic Phospholipase A2 (PLA2G4)
SIPB828Hu02-01 10 µg

Recombinant Cytosolic Phospholipase A2 (PLA2G4)

Ask
View Details
Recombinant Cytosolic Phospholipase A2 (PLA2G4)
SIPB828Hu02-02 50 µg

Recombinant Cytosolic Phospholipase A2 (PLA2G4)

Ask
View Details
Recombinant Cytosolic Phospholipase A2 (PLA2G4)
SIPB828Hu02-03 200 µg

Recombinant Cytosolic Phospholipase A2 (PLA2G4)

Ask
View Details
Recombinant Cytosolic Phospholipase A2 (PLA2G4)
SIPB828Hu02-04 1 mg

Recombinant Cytosolic Phospholipase A2 (PLA2G4)

Ask
View Details