Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trefoil Factor 3/TFF3 (C-6His)

Source: Human Cells. MW :7.3kD. Recombinant Mouse Trefoil Factor 3 is produced by our Mammalian expression system and the target gene encoding Ala23-Phe81 is expressed with a 6His at the C-terminus. Trefoil factors (TFF) are secretory products of mucin producing cells. They play a key role in the maintenance of the surface integrity of oral mucosa and enhance healing of the gastrointestinal mucosa by a process called restitution. TFF comprises the gastric peptides (TFF1), spasmolytic peptide (TFF2), and the intestinal trefoil factor (TFF3) . They have an important and necessary role in epithelial restitution within the gastrointestinal tract. Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfide bonds. They are stable secretory proteins expressed in gastrointestinal mucosa. Trefoil Factor 3 (TFF3) is involved in the maintenance and repair of the intestinal mucosa. TFF3 promotes the mobility of epithelial cells in healing processes (motogen) .

Product Specifications

Gene Name

Tff3

Gene ID

21786

UniProt

Q62395

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTFHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal CD200R1 Antibody (019) [DyLight 755]
NBP2-90481IR 0.1 mL

Rabbit Monoclonal CD200R1 Antibody (019) [DyLight 755]

Ask
View Details
ZNF385 (ZNF385A) (NM_001290002) Human Untagged Clone
SC335647 10 µg

ZNF385 (ZNF385A) (NM_001290002) Human Untagged Clone

Ask
View Details
Rno-miR-673-3p miRNA Agomir
CMS0534-01 5 nmol

Rno-miR-673-3p miRNA Agomir

Ask
View Details
Rno-miR-673-3p miRNA Agomir
CMS0534-02 10 nmol

Rno-miR-673-3p miRNA Agomir

Ask
View Details
Rno-miR-673-3p miRNA Agomir
CMS0534-03 20 nmol

Rno-miR-673-3p miRNA Agomir

Ask
View Details
Anti- Adenosine A3 receptor Antibody
GWB-5D7DB7 0.05 mL

Anti- Adenosine A3 receptor Antibody

Ask
View Details