Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trefoil Factor 3/TFF3 (C-6His)

Source: Human Cells. MW :7.3kD. Recombinant Mouse Trefoil Factor 3 is produced by our Mammalian expression system and the target gene encoding Ala23-Phe81 is expressed with a 6His at the C-terminus. Trefoil factors (TFF) are secretory products of mucin producing cells. They play a key role in the maintenance of the surface integrity of oral mucosa and enhance healing of the gastrointestinal mucosa by a process called restitution. TFF comprises the gastric peptides (TFF1), spasmolytic peptide (TFF2), and the intestinal trefoil factor (TFF3) . They have an important and necessary role in epithelial restitution within the gastrointestinal tract. Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfide bonds. They are stable secretory proteins expressed in gastrointestinal mucosa. Trefoil Factor 3 (TFF3) is involved in the maintenance and repair of the intestinal mucosa. TFF3 promotes the mobility of epithelial cells in healing processes (motogen) .

Product Specifications

Gene Name

Tff3

Gene ID

21786

UniProt

Q62395

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTFHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DUX4 activation kit by CRISPRa
GA119236 1 Kit

Human DUX4 activation kit by CRISPRa

Sign In for Pricing
View Details
Prostaglandin E2-d4
TRC-P838612-1MG 1 mg

Prostaglandin E2-d4

Sign In for Pricing
View Details
Glycolaldehyde-1,2-13C2 (0.1 M in water)
TRC-G641104-5MG 5 mg

Glycolaldehyde-1,2-13C2 (0.1 M in water)

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS710219 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
ATAD2 Recombinant Rabbit Monoclonal Antibody [JE34-52]
HA721905 100 µL

ATAD2 Recombinant Rabbit Monoclonal Antibody [JE34-52]

Sign In for Pricing
View Details
Ethyl Geranylether
TRC-E259065-500MG 500 mg

Ethyl Geranylether

Sign In for Pricing
View Details