Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trefoil Factor 1/TFF1 (C-6His)

Source: Human Cells. MW :7.5kD. Recombinant Human Trefoil Factor 1 is produced by our Mammalian expression system and the target gene encoding Glu25-Phe84 is expressed with a 6His at the C-terminus. Trefoil Factor 1 (TFF1) belongs to the three structurally related secreted proteins that contain trefoil domains. TFF1 is an approximately 7 kDa peptide that plays an important role in epithelial regeneration and wound healing. It is highly expressed in goblet cells of the gastric and intestinal mucosa and by conjunctival goblet cells. By conserving intrachain disulfide bonds, human TFF1 formed a three-leaved conformation held together.It is a copper-binding protein that can form disulfide-linked homodimers, associate into disulfide-linked complexes with Gastrokine 2, and form non-covalent complexes with the mucin MUC5AC. TFF1 is down-regulated during the progression from gastritis to gastric dysplasia to gastric cancer, although it is up-regulated in breast and prostate cancers.

Product Specifications

Gene Name

TFF1

Gene ID

7031

UniProt

P04155

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT 031374 hydrobromide
B5679-50 50 mg

CCT 031374 hydrobromide

Sign In for Pricing
View Details
ORC6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV698721 1.0 µg DNA

ORC6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit Polyclonal TCTN1 Antibody
NBP2-94021-0.02mL 0.02 mL

Rabbit Polyclonal TCTN1 Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD3E Antibody[CRIS-7]
AN003740P-01 25 µg

Purified Anti-Human CD3E Antibody[CRIS-7]

Sign In for Pricing
View Details
Purified Anti-Human CD3E Antibody[CRIS-7]
AN003740P-02 100 µg

Purified Anti-Human CD3E Antibody[CRIS-7]

Sign In for Pricing
View Details
Purified Anti-Human CD3E Antibody[CRIS-7]
AN003740P-03 1 mg

Purified Anti-Human CD3E Antibody[CRIS-7]

Sign In for Pricing
View Details