Recombinant Human Trefoil Factor 1/TFF1 (C-6His)
Source: Human Cells. MW :7.5kD. Recombinant Human Trefoil Factor 1 is produced by our Mammalian expression system and the target gene encoding Glu25-Phe84 is expressed with a 6His at the C-terminus. Trefoil Factor 1 (TFF1) belongs to the three structurally related secreted proteins that contain trefoil domains. TFF1 is an approximately 7 kDa peptide that plays an important role in epithelial regeneration and wound healing. It is highly expressed in goblet cells of the gastric and intestinal mucosa and by conjunctival goblet cells. By conserving intrachain disulfide bonds, human TFF1 formed a three-leaved conformation held together.It is a copper-binding protein that can form disulfide-linked homodimers, associate into disulfide-linked complexes with Gastrokine 2, and form non-covalent complexes with the mucin MUC5AC. TFF1 is down-regulated during the progression from gastritis to gastric dysplasia to gastric cancer, although it is up-regulated in breast and prostate cancers.
Product Specifications
Gene Name
TFF1
Gene ID
7031
UniProt
P04155
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEFHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items