Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zymogen Granule Membrane Protein 16/ZG16 (C-6His)

Source: Human Cells. MW :17.7kD. Recombinant Human Zymogen Granule Membrane Protein 16 is produced by our Mammalian expression system and the target gene encoding Asn17-Cys167 is expressed with a 6His tag at the C-terminus. Zymogen Granule Membrane Protein 16 (ZG16) belongs to the jacalin lectin family. ZG16 is highly expressed in liver and is detected at lower levels in colon, ileum and jejunum. ZG16 may play a role in protein trafficking. In addition, ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Product Specifications

Gene Name

ZG16

Gene ID

653808

UniProt

O60844

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRCVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1457686-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1457686-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1457686-03 0.02 mg (Baculovirus)

Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1457686-04 0.02 mg (Mammalian-Cell)

Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1457686-05 1 mg (E-Coli)

Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1457686-06 0.1 mg (Baculovirus)

Recombinant Yersinia pestis bv. Antiqua Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details