Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vanin-2/VNN2 (C-6His)

Source: Human Cells. MW :54.23kD. Recombinant Human Vascular Non-Inflammatory Molecule 2 is produced by our Mammalian expression system and the target gene encoding Gln23-Ser492 is expressed with a 6His tag at the C-terminus. Vascular Non-Inflammatory Molecule 2 (VNN2) is a member of the CN hydrolase family. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. they possess pantetheinase activity, which may play a role in oxidative-stress response. VNN2 is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. VNN2 involved in the thymus homing of bone marrow cells. In addition, VNN2 may regulate beta-2 integrin-mediated cell adhesion, migration and motility of neutrophil.

Product Specifications

Gene Name

VNN2

Gene ID

8875

UniProt

O95498

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTMLKCKTTNLTTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IgM (APC)
MBS6126899-01 0.1 mL

IgM (APC)

Ask
View Details
IgM (APC)
MBS6126899-02 5x 0.1 mL

IgM (APC)

Ask
View Details
EPHA2 Rabbit pAb
E45R27177N-100 100 µL

EPHA2 Rabbit pAb

Ask
View Details
B.Q.Vaccine HiCynth™ Medium (Thioglycollate HiCynth™ Broth)
MCD462-500G 500 g

B.Q.Vaccine HiCynth™ Medium (Thioglycollate HiCynth™ Broth)

Ask
View Details
Rabbit anti-Homo sapiens (Human) DOLK Polyclonal Antibody
MBS7138880 Inquire

Rabbit anti-Homo sapiens (Human) DOLK Polyclonal Antibody

Ask
View Details
MAGEB3, NT (Melanoma-associated Antigen B3, MAGE-B3 Antigen) (Biotin) discontinued
M1750-24-Biotin 200 µL

MAGEB3, NT (Melanoma-associated Antigen B3, MAGE-B3 Antigen) (Biotin) discontinued

Ask
View Details