Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human THSD1/TMTSP (C-6His)

Source: Human Cells. MW :38.83kD. Recombinant Human THSD1 is produced by our Mammalian expression system and the target gene encoding Glu25-Ile361 is expressed with a 6His tag at the C-terminus. Thrombospondin Type-1 Domain-Containing Protein 1 (THSD1) is a single-pass type I membrane protein. THSD1 contains a signal peptide and one TSP type-1 domain that is found in thrombospondin. THSD1 is a good novel candidate for TSG as it has been mapped to 13q14. Alternatively spliced transcript variants encoding distinct isoforms have been observed. THSD1 may be involved in the complement pathway.

Product Specifications

Gene Name

THSD1

Gene ID

55901

UniProt

Q9NS62

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNIVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OXLD1 (NM_001039842) Human Over-expression Lysate
LY421836 100 µg

OXLD1 (NM_001039842) Human Over-expression Lysate

Sign In for Pricing
View Details
C12orf56 (NM_001170633) Human Over-expression Lysate
LC433360 20 µg

C12orf56 (NM_001170633) Human Over-expression Lysate

Sign In for Pricing
View Details
GRASP65 (GORASP1) (NM_031899) Human Over-expression Lysate
LC403127 20 µg

GRASP65 (GORASP1) (NM_031899) Human Over-expression Lysate

Sign In for Pricing
View Details
Adipic Acid Dihydrazide
TRC-A291595-25G 25 g

Adipic Acid Dihydrazide

Sign In for Pricing
View Details
Laboratory Water Purification System BLPS-401
BLPS-401 1 Unit

Laboratory Water Purification System BLPS-401

Sign In for Pricing
View Details
2,6-Dichloropyridine-3,4,5-D3
TRC-D229883-50MG 50 mg

2,6-Dichloropyridine-3,4,5-D3

Sign In for Pricing
View Details