Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human THSD1/TMTSP (C-6His)

Source: Human Cells. MW :38.83kD. Recombinant Human THSD1 is produced by our Mammalian expression system and the target gene encoding Glu25-Ile361 is expressed with a 6His tag at the C-terminus. Thrombospondin Type-1 Domain-Containing Protein 1 (THSD1) is a single-pass type I membrane protein. THSD1 contains a signal peptide and one TSP type-1 domain that is found in thrombospondin. THSD1 is a good novel candidate for TSG as it has been mapped to 13q14. Alternatively spliced transcript variants encoding distinct isoforms have been observed. THSD1 may be involved in the complement pathway.

Product Specifications

Gene Name

THSD1

Gene ID

55901

UniProt

Q9NS62

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNIVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLL1 (NM_012464) Human Recombinant Protein
TP323360 20 µg

TLL1 (NM_012464) Human Recombinant Protein

Sign In for Pricing
View Details
PEX26 (NM_001127649) Human Over-expression Lysate
LY426835 100 µg

PEX26 (NM_001127649) Human Over-expression Lysate

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), 1mg/mL
BNUM0821-50 1x 50 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), 1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF405S conjugate, 0.1mg/mL
BNC041149-500 1x 500 µL

CD71 (TFRC/1149), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOR1AIP1 Antibody
KC-30771-01 50 μL

TOR1AIP1 Antibody

Sign In for Pricing
View Details
TOR1AIP1 Antibody
KC-30771-02 100 µL

TOR1AIP1 Antibody

Sign In for Pricing
View Details