Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Semenogelin-1/SEMG1 (C-6His)

Source: Human Cells. MW :43.8kD. Recombinant Human Semenogelin-1 is produced by our Mammalian expression system and the target gene encoding Gln24-Thr402 is expressed with a 6His tag at the C-terminus. Semenogelin-1 (SEMG1) is the predominant protein in semen; it is a secretory protein involved in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes SEMG1 into smaller peptides, each possibly having a separate function. In the proteolysis process, Alpha-inhibin-92 and alpha-inhibin-31 are produced; they inhibit the secretion of pituitary follicle-stimulating hormone. At the same time, it breaks down the gel matrix, allowing the spermatozoa to move more freely.

Product Specifications

Gene Name

SEMG1

Gene ID

6406

UniProt

P04279

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Hac-NaAc, 150mM NaCl, pH 4.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDQNPLFTVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Cadherin 74A Antibody BIOTIN
STJ500346 100 µg

Anti-Cadherin 74A Antibody BIOTIN

Ask
View Details
Anti-Kalirin Antibody
CPA2341-01 30 µL

Anti-Kalirin Antibody

Ask
View Details
Anti-Kalirin Antibody
CPA2341-02 50 μL

Anti-Kalirin Antibody

Ask
View Details
Anti-Kalirin Antibody
CPA2341-03 100 µL

Anti-Kalirin Antibody

Ask
View Details
Anti-Kalirin Antibody
CPA2341-04 200 µL

Anti-Kalirin Antibody

Ask
View Details
Lentiviral human ZFPM2 sgRNA gene knockout kit - Lentiviral human ZFPM2 sgRNA gene knockout kit (100)
GTR15395326 1 Vial

Lentiviral human ZFPM2 sgRNA gene knockout kit - Lentiviral human ZFPM2 sgRNA gene knockout kit (100)

Ask
View Details