Recombinant Human Serum Amyloid A1/SAA1 (N-6His)
Source: E.coli. MW :13.2kD. Recombinant Human Serum Amyloid A1 Protein is produced by our E.coli expression system and the target gene encoding Arg19-Tyr122 is expressed with a 6His tag at the N-terminus. Serum Amyloid A1 Protein (SAA1) is an acute phase apolipoprotein reactant that is produced predominantly by hepatocytes and is under the regulation of inflammatory cytokines. SAA is produced mainly in the liver and circulates in low levels in the blood. SAA may play a role in the immune system and facilitate the repair of injured tissues, it also acts as an antibacterial agent, and signals the migration of germ-fighting cells to sites of infection. SAA also functions as an apolipoprotein of the HDL complex. The SAA cleavage product designated amyloid protein A is deposited systemically as amyloid in vital organs such as the liver, spleen, and kidneys in chronic inflammatory diseases patients. These deposits are extremely insoluble and resistant to proteolysis; they disrupt tissue structure and compromise performance.
Product Specifications
Gene Name
SAA1
Gene ID
6288
UniProt
P0DJI8
Components
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM EDTA, pH 8.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
Explore Other Products
Browse additional items from our catalog