Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serum Amyloid A1/SAA1 (N-6His)

Source: E.coli. MW :13.2kD. Recombinant Human Serum Amyloid A1 Protein is produced by our E.coli expression system and the target gene encoding Arg19-Tyr122 is expressed with a 6His tag at the N-terminus. Serum Amyloid A1 Protein (SAA1) is an acute phase apolipoprotein reactant that is produced predominantly by hepatocytes and is under the regulation of inflammatory cytokines. SAA is produced mainly in the liver and circulates in low levels in the blood. SAA may play a role in the immune system and facilitate the repair of injured tissues, it also acts as an antibacterial agent, and signals the migration of germ-fighting cells to sites of infection. SAA also functions as an apolipoprotein of the HDL complex. The SAA cleavage product designated amyloid protein A is deposited systemically as amyloid in vital organs such as the liver, spleen, and kidneys in chronic inflammatory diseases patients. These deposits are extremely insoluble and resistant to proteolysis; they disrupt tissue structure and compromise performance.

Product Specifications

Gene Name

SAA1

Gene ID

6288

UniProt

P0DJI8

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM EDTA, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : '

Amino Acids

MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Epn1 (NM_001252454) AAV Particle
MR230560A1V 250 µL

Mouse Epn1 (NM_001252454) AAV Particle

Ask
View Details
Anti-Phospho-Tuberin (Ser939) Polyclonal Antibody
MF-0087228-01 50 µL

Anti-Phospho-Tuberin (Ser939) Polyclonal Antibody

Ask
View Details
Anti-Phospho-Tuberin (Ser939) Polyclonal Antibody
MF-0087228-02 100 µL

Anti-Phospho-Tuberin (Ser939) Polyclonal Antibody

Ask
View Details
CPA5 (NM_001127441) Human Tagged ORF Clone Lentiviral Particle
RC225716L4V 200 µL

CPA5 (NM_001127441) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
AKT1 (RAC-alpha Serine/Threonine-protein Kinase, Protein Kinase B, PKB, Proto-oncogene c-Akt, RAC-PK-alpha, PKB, RAC) discontinued
215231 100 µg

AKT1 (RAC-alpha Serine/Threonine-protein Kinase, Protein Kinase B, PKB, Proto-oncogene c-Akt, RAC-PK-alpha, PKB, RAC) discontinued

Ask
View Details
Lentiviral mouse Pon1 shRNA (UAS) - Lentiviral mouse Pon1 shRNA (UAS) plasmid
GTR15223231 1 Vial

Lentiviral mouse Pon1 shRNA (UAS) - Lentiviral mouse Pon1 shRNA (UAS) plasmid

Ask
View Details