Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteinase 3/PRTN3/Myeloblastin (C-6His)

Source: Human Cells. MW :25.64kD. Recombinant Human Proteinase 3 is produced by our Mammalian expression system and the target gene encoding Ala26-Arg249 is expressed with a 6His tag at the C-terminus. Proteinase-3 is a neutral serine proteinase that belongs to the peptidase S1 family and Elastase subfamily. It contains one peptidase S1 domain and it is expressed mainly in neutrophil granulocytes. The primary function of Proteinase-3 is thought to be degradation of extracellular proteins at sites of inflammation, but excessive or prolonged proteolytic activity may cause harmful effects in the body. It is the epitope of anti-neutrophil cytoplasmic antibodies (ANCAs) of the cANCA (cytoplasmic subtype) class, a type of antibody frequently found in the disease Wegener's granulomatosis.

Product Specifications

Gene Name

PRTN3

Gene ID

5657

UniProt

P24158

Components

Supplied as a 0.2 μm filtered solution of 10mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL-23R Protein, Canine, Recombinant (His)
MF-0130979-01 5 µg

IL-23R Protein, Canine, Recombinant (His)

Ask
View Details
IL-23R Protein, Canine, Recombinant (His)
MF-0130979-02 10 µg

IL-23R Protein, Canine, Recombinant (His)

Ask
View Details
IL-23R Protein, Canine, Recombinant (His)
MF-0130979-03 20 µg

IL-23R Protein, Canine, Recombinant (His)

Ask
View Details
IL-23R Protein, Canine, Recombinant (His)
MF-0130979-04 50 µg

IL-23R Protein, Canine, Recombinant (His)

Ask
View Details
IL-23R Protein, Canine, Recombinant (His)
MF-0130979-05 100 µg

IL-23R Protein, Canine, Recombinant (His)

Ask
View Details
IL-23R Protein, Canine, Recombinant (His)
MF-0130979-06 200 µg

IL-23R Protein, Canine, Recombinant (His)

Ask
View Details