Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein 2/KLK2 (C-6His)

Source: Human Cells. MW :27.9kD. Recombinant Human Kallikrein 2 is produced by our Mammalian expression system and the target gene encoding Pro19-Pro261 is expressed with a 6His tag at the C-terminus. Kallikrein-2 (KLK2) is a secreted serine protease that belongs to the peptidase S1 family of Kallikrein subfamily. KLK2 contains 1 peptidase S1 domain. It is highly expressed in the human prostate gland. KLK2 can cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin, but Preferential cleavages of Arg-|-Xaa bonds in small molecule substrates. It also highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa. KLK2 is inhibited by serpins such as protein C inhibitor, antichymotrypsin, and plasminogen. KLK2 is considered to be a biomarker for prostate cancer.

Product Specifications

Gene Name

KLK2

Gene ID

3817

UniProt

P20151

Components

Supplied as a 0.2 μm filtered solution of 20mM Citrate, 150mM NaCl, pH 3.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-GPR75 antibody
STJ93395 200 µl

Anti-GPR75 antibody

Ask
View Details
TET2 (C-7) Alexa Fluor® 546
sc-398535 AF546 200 µg/mL

TET2 (C-7) Alexa Fluor® 546

Ask
View Details
Mgat4d (NM_026233) Mouse Tagged ORF Clone Lentiviral Particle
MR217761L3V 200 µL

Mgat4d (NM_026233) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details