Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein 2/KLK2 (C-6His)

Source: Human Cells. MW :27.9kD. Recombinant Human Kallikrein 2 is produced by our Mammalian expression system and the target gene encoding Pro19-Pro261 is expressed with a 6His tag at the C-terminus. Kallikrein-2 (KLK2) is a secreted serine protease that belongs to the peptidase S1 family of Kallikrein subfamily. KLK2 contains 1 peptidase S1 domain. It is highly expressed in the human prostate gland. KLK2 can cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin, but Preferential cleavages of Arg-|-Xaa bonds in small molecule substrates. It also highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa. KLK2 is inhibited by serpins such as protein C inhibitor, antichymotrypsin, and plasminogen. KLK2 is considered to be a biomarker for prostate cancer.

Product Specifications

Gene Name

KLK2

Gene ID

3817

UniProt

P20151

Components

Supplied as a 0.2 μm filtered solution of 20mM Citrate, 150mM NaCl, pH 3.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep Galanin Receptor Type 2 (GALR2) ELISA Kit
MBS9939144-01 48 Well

Sheep Galanin Receptor Type 2 (GALR2) ELISA Kit

Ask
View Details
Sheep Galanin Receptor Type 2 (GALR2) ELISA Kit
MBS9939144-02 96 Well

Sheep Galanin Receptor Type 2 (GALR2) ELISA Kit

Ask
View Details
Sheep Galanin Receptor Type 2 (GALR2) ELISA Kit
MBS9939144-03 5x 96 Well

Sheep Galanin Receptor Type 2 (GALR2) ELISA Kit

Ask
View Details
Sheep Galanin Receptor Type 2 (GALR2) ELISA Kit
MBS9939144-04 10x 96 Well

Sheep Galanin Receptor Type 2 (GALR2) ELISA Kit

Ask
View Details
PTGIR (PRIPR, Prostacyclin Receptor, Prostaglandin I2 Receptor, Prostanoid IP Receptor, MGC102830)
MBS642084-01 0.1 mg

PTGIR (PRIPR, Prostacyclin Receptor, Prostaglandin I2 Receptor, Prostanoid IP Receptor, MGC102830)

Ask
View Details
PTGIR (PRIPR, Prostacyclin Receptor, Prostaglandin I2 Receptor, Prostanoid IP Receptor, MGC102830)
MBS642084-02 5x 0.1 mg

PTGIR (PRIPR, Prostacyclin Receptor, Prostaglandin I2 Receptor, Prostanoid IP Receptor, MGC102830)

Ask
View Details