Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C Motif Chemokine 1/CXCL1 (C-6His)

Source: Human Cells. MW :8.9kD. Recombinant Human C-X-C Motif Chemokine 1 is produced by our Mammalian expression system and the target gene encoding Ala35-Asn107 is expressed with a 6His tag at the C-terminus. Chemokine (C-X-C motif) Ligand 1 Protein (CXCL1) is a growth factor for melanoma cells and a chemotaxin for neutrophils and a member of the CXC chemokine family that is a potent neutrophil attractant and activator and is also active toward basophils. CXCL1 is expressed by macrophages, neutrophils and epithelial cells; it has neutrophil chemoattractant activity. CXCL1 plays a critical nonredundant role in the development of experimental Lyme arthritis and carditis via CXCR2-mediated recruitment of neutrophils into the site of infection and may also have important pro-nociceptive effects via its direct actions on sensory neurons, and may induce long-term changes that involve protein synthesis.

Product Specifications

Gene Name

CXCL1

Gene ID

2919

UniProt

P09341

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSNVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPC111 (NOP16) (NM_001291307) Human Tagged ORF Clone
RC235964 10 µg

HSPC111 (NOP16) (NM_001291307) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Cathepsin B Antibody [Alexa Fluor 594]
NBP1-19797AF594 0.1 mL

Rabbit Polyclonal Cathepsin B Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Tiamulin
T091-25MG 25 mg

Tiamulin

Sign In for Pricing
View Details
Human TNFRSF13B Knockout HEK293T cell line
GTR15422440 1 Vial

Human TNFRSF13B Knockout HEK293T cell line

Sign In for Pricing
View Details
CD19 Polyclonal Antibody
RD86824A-01 60 μL

CD19 Polyclonal Antibody

Sign In for Pricing
View Details
CD19 Polyclonal Antibody
RD86824A-02 120 μL

CD19 Polyclonal Antibody

Sign In for Pricing
View Details