Recombinant Human C-X-C Motif Chemokine 1/CXCL1 (C-6His)
Source: Human Cells. MW :8.9kD. Recombinant Human C-X-C Motif Chemokine 1 is produced by our Mammalian expression system and the target gene encoding Ala35-Asn107 is expressed with a 6His tag at the C-terminus. Chemokine (C-X-C motif) Ligand 1 Protein (CXCL1) is a growth factor for melanoma cells and a chemotaxin for neutrophils and a member of the CXC chemokine family that is a potent neutrophil attractant and activator and is also active toward basophils. CXCL1 is expressed by macrophages, neutrophils and epithelial cells; it has neutrophil chemoattractant activity. CXCL1 plays a critical nonredundant role in the development of experimental Lyme arthritis and carditis via CXCR2-mediated recruitment of neutrophils into the site of infection and may also have important pro-nociceptive effects via its direct actions on sensory neurons, and may induce long-term changes that involve protein synthesis.
Product Specifications
Gene Name
CXCL1
Gene ID
2919
UniProt
P09341
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, pH 7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSNVDHHHHHH
Explore Other Products
Browse additional items from our catalog