Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Corticotropin-Releasing Factor-Binding Protein/CRHBP (C-6His)

Source: Human Cells. MW :34.38kD. Recombinant Human CRHBP is produced by our Mammalian expression system and the target gene encoding Tyr25-Leu322 is expressed with a 6His tag at the C-terminus. Corticotropin-Releasing Factor-Binding Protein (CRHBP) is a 37 kDa secreted glycoprotein that binds both CRH and urocortin in a 42 kDa extracellular complex. The molecule is approximately 300 amino acids in length and demonstrates five intrachain disulfide bonds. Difference between CRHBP from different species exist, human CRHBP is found in plasma while rodent and sheep CRHBP is limited to neuroendocrine tissues. CRHBP may inactivate CRH and may prevent inappropriate pituitary-adrenal stimulation in pregnancy. CRHBP is presumed to either sequester CRH, rendering it unavailable to cells or transport it to target tissues. Although CRF-BP concentration in the human peripheral circulation is normally low, it increases throughout pregnancy and fall back rapidly after parturition.

Product Specifications

Gene Name

CRHBP

Gene ID

1393

UniProt

P24387

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mm NaCl, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGLVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZFAND3 (AN1-type Zinc Finger Protein 3, Testis-expressed Sequence 27, TEX27) (PE)
135541-PE 100 µL

ZFAND3 (AN1-type Zinc Finger Protein 3, Testis-expressed Sequence 27, TEX27) (PE)

Ask
View Details
HK2 Antibody
A45237-100UL 100 µL

HK2 Antibody

Ask
View Details
CoC1/DDP Cell Complete Medium
CM-0065 4x 125 mL

CoC1/DDP Cell Complete Medium

Ask
View Details
PLA2G4A Rabbit pAb (APR17436N)
APR17436N-01 50 µL

PLA2G4A Rabbit pAb (APR17436N)

Ask
View Details
PLA2G4A Rabbit pAb (APR17436N)
APR17436N-02 100 µL

PLA2G4A Rabbit pAb (APR17436N)

Ask
View Details
PLA2G4A Rabbit pAb (APR17436N)
APR17436N-03 200 µL

PLA2G4A Rabbit pAb (APR17436N)

Ask
View Details