Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Corneodesmosin/CDSN (C-6His)

Source: Human Cells. MW :49.3kD. Recombinant Human Corneodesmosin is produced by our Mammalian expression system and the target gene encoding Lys33-Pro528 is expressed with a 6His tag at the C-terminus. Corneodesmosin is a protein that is encoded by the CDSN gene in humans. This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation.

Product Specifications

Gene Name

CDSN

Gene ID

1041

UniProt

Q15517

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSGSSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGSSGSHSGSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISGSSGLPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLDSPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human TECPR1 Pre-designed siRNA Set B
SI016437B 1 Each

Human TECPR1 Pre-designed siRNA Set B

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)
MBS1304527-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)
MBS1304527-02 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)
MBS1304527-03 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)
MBS1304527-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)

Ask
View Details
Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)
MBS1304527-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Uncharacterized peptidase SAUSA300_1654 (SAUSA300_1654)

Ask
View Details